PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0094800
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GRAS
Protein Properties Length: 612aa    MW: 67853.7 Da    PI: 4.9673
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0094800genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.53.9e-1092175222310
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL++cA a+s++++ +a+a++++l++++s +gdp+qRl ay++e+Laar+++s++++ykal+++e +   + ++l+a+++++e++P++kf+++
  Spipo4G0094800 217 KQLLFDCAAAMSEDNFGEASAAITELRQMVSIQGDPVQRLSAYMVEGLAARIVSSGKGIYKALRCKEPP---TLDRLSAMQVLFEICPCFKFGFM 308
                     699*****************************************************************9...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     +aN aI eav++e++vHiiDfd++qG Q+++L++aL++  + +p+lRiTgv++pes+      l+ +g+rL+k+Aeelg+pfef++l   ++ ++
  Spipo4G0094800 309 AANGAIAEAVKNEDKVHIIDFDVNQGSQYITLMEALSTW-RTKPKLRITGVDDPESVqrTVGGLKIIGQRLEKLAEELGIPFEFRAL-GVNTGNI 401
                     *************************************96.5669***********99778889***********************5.8889999 PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++++++++pgEal+Vn+++qlh+++desvs+ ++rd++L++vk+l+Pk+v++veq++++n+++F+ rf+e  +yysa+f sl+a+lpres +r++
  Spipo4G0094800 402 TPSMFACRPGEALVVNFAFQLHHMPDESVSTVNQRDKLLRMVKGLRPKLVTIVEQDVNTNTAPFFPRFVEVYNYYSAVFKSLDATLPRESPDRMN 496
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhe 310
                     vEr++l+r+ivn+vaceg +r+er+ 
  Spipo4G0094800 497 VERQCLARDIVNIVACEGMDRIERQG 522
                     ***********************986 PP

2GRAS46.27.8e-15542611304374
            GRAS 304 errerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     + ++r e ++kW++r+++aGF + p+s+++   +  ll+ + ++ y+ e+  g+l++gW++++L+++SaW+
  Spipo4G0094800 542 SCTNRYEVAGKWKARMTMAGFVSCPISSEVKGAIGKLLKAYCDR-YTAEDVGGALCFGWENKSLIVASAWK 611
                     557899***********************************966.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098559.562190592IPR005202Transcription factor GRAS
PfamPF035141.3E-106217522IPR005202Transcription factor GRAS
PfamPF035142.7E-12542611IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 612 aa     Download sequence    Send to blast
MSLIRSADSS TNSFGELNLY VRKKSGDNAS LSNQLYDMDG RILNYRPEPY RSDYQQYFSR  60
TSSGLVQEIM INNPSDSSSP GSWFHADSSS AAYRSVDDSG SFVTIQNKSG SCFNPVSDSQ  120
RLVGLSYQNS VSLSDDQSPG NPIDYDEDEI KSKLRELERE LLDDVDDELL DTEEGLSIDE  180
DWVEPMKNLL RPTSPKESSS GSNITSVDSI KEPRTAKQLL FDCAAAMSED NFGEASAAIT  240
ELRQMVSIQG DPVQRLSAYM VEGLAARIVS SGKGIYKALR CKEPPTLDRL SAMQVLFEIC  300
PCFKFGFMAA NGAIAEAVKN EDKVHIIDFD VNQGSQYITL MEALSTWRTK PKLRITGVDD  360
PESVQRTVGG LKIIGQRLEK LAEELGIPFE FRALGVNTGN ITPSMFACRP GEALVVNFAF  420
QLHHMPDESV STVNQRDKLL RMVKGLRPKL VTIVEQDVNT NTAPFFPRFV EVYNYYSAVF  480
KSLDATLPRE SPDRMNVERQ CLARDIVNIV ACEGMDRIER QGRVLSVCSY AAVSRIPIHH  540
FSCTNRYEVA GKWKARMTMA GFVSCPISSE VKGAIGKLLK AYCDRYTAED VGGALCFGWE  600
NKSLIVASAW K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-502186116375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009380015.10.0PREDICTED: scarecrow-like protein 1
SwissprotQ9SDQ30.0SCL1_ARATH; Scarecrow-like protein 1
TrEMBLM0RJ040.0M0RJ04_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P17290_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51753860
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21450.10.0SCARECROW-like 1